PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009593358.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 267aa    MW: 30867.7 Da    PI: 6.309
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009593358.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.8e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +lv+ +   G  +W+tI++  g+ R++k+c++rw +yl
   XP_009593358.1 14 RGPWTIEEDHKLVHFILNNGIQCWRTIPKLAGLQRCGKSCRLRWINYL 61
                     89********************************************97 PP

2Myb_DNA-binding52.88.9e-1767110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++ E++++++++++lG++ W++Ia++++ gRt++++k++w++
   XP_009593358.1  67 RGALSEAEEDQIIQLHARLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                      78889*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.004961IPR017930Myb domain
SuperFamilySSF466891.2E-2811108IPR009057Homeodomain-like
SMARTSM007176.2E-71363IPR001005SANT/Myb domain
PfamPF002492.1E-121461IPR001005SANT/Myb domain
CDDcd001671.74E-51661No hitNo description
PROSITE profilePS5129426.89262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2565117IPR009057Homeodomain-like
SMARTSM007171.2E-1566114IPR001005SANT/Myb domain
PfamPF002491.9E-1567110IPR001005SANT/Myb domain
CDDcd001674.78E-1171110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRQPCCDKV GLKRGPWTIE EDHKLVHFIL NNGIQCWRTI PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAL SEAEEDQIIQ LHARLGNRWS KIASHFPGRT DNEIKNHWNT RIKKKLKQVG  120
IDPLTHKPID QEKYQQEPDD TIMELNLPIR HYKTETYDKS NEAENCTENA TDFSLSNNAY  180
HNMLSENFDV DLWNKSCKTM SNCYSPTLSL EVEESINFST VSAATESSSN VAPAEEQDSL  240
QQWMDSIFSC AVNQLEEDLF LLRKYNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153763e-49AC215376.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0072B02, complete sequence.
GenBankAC2154643e-49AC215464.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02SLe0121H01, complete sequence.
GenBankAC2358013e-49AC235801.1 Solanum lycopersicum chromosome 3 clone C03HBa0140L21, complete sequence.
GenBankHG9755143e-49HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009593357.10.0PREDICTED: protein ODORANT1-like
RefseqXP_009593358.10.0PREDICTED: protein ODORANT1-like
RefseqXP_016462514.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX66e-75ODO1_PETHY; Protein ODORANT1
TrEMBLM1AYB91e-150M1AYB9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000329301e-150(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.12e-83myb domain protein 40